Lineage for d3atja_ (3atj A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5254Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 5255Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 5256Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 5362Protein Plant peroxidase [48125] (6 species)
  7. 5365Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (5 PDB entries)
  8. 5370Domain d3atja_: 3atj A: [18677]

Details for d3atja_

PDB Entry: 3atj (more details), 2.2 Å

PDB Description: heme ligand mutant of recombinant horseradish peroxidase in complex with benzhydroxamic acid

SCOP Domain Sequences for d3atja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3atja_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdmdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvnsn

SCOP Domain Coordinates for d3atja_:

Click to download the PDB-style file with coordinates for d3atja_.
(The format of our PDB-style files is described here.)

Timeline for d3atja_: