Lineage for d4dbka_ (4dbk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015999Protein automated matches [190139] (26 species)
    not a true protein
  7. 2016122Species Pig (Sus scrofa) [TaxId:9823] [186957] (9 PDB entries)
  8. 2016126Domain d4dbka_: 4dbk A: [186746]
    automated match to d1hn4a_
    complexed with ber, ca

Details for d4dbka_

PDB Entry: 4dbk (more details), 2.3 Å

PDB Description: Crystal structure of porcine pancreatic phospholipase A2 complexed with berberine
PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d4dbka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dbka_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

SCOPe Domain Coordinates for d4dbka_:

Click to download the PDB-style file with coordinates for d4dbka_.
(The format of our PDB-style files is described here.)

Timeline for d4dbka_: