SCOPe 2.08: Domain d4affa1: 4aff A:1-112

Lineage for d4affa1 (4aff A:1-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (7 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:32046] [189889] (2 PDB entries)

8. Domain d4affa1: 4aff A:1-112 [186745]
   Other proteins in same PDB: d4affa2
   automated match to d1qy7a_
   complexed with atp, flc, mg; mutant

Details for d4affa1

PDB Entry: 4aff, 1.05 Å

PDB Description: High resolution structure of a PII mutant (I86N) protein in complex with ATP, MG and FLC

PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4affa1:

Sequence, based on SEQRES records:

>d4affa1 d.58.5.1 (A:1-112) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgengdgkifvspvdqtirirtgeknadai

Sequence, based on observed residues (ATOM records):

>d4affa1 d.58.5.1 (A:1-112) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkrgseytveflqklkleivve
daqvdtvidkivaaartgengdgkifvspvdqtirirtgeknadai

Timeline for d4affa1:

• d4affa1 first appeared in SCOPe 2.01, called d4affa_
  
• d4affa1 appears in SCOPe 2.07