Lineage for d4affa1 (4aff A:1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950640Protein automated matches [190670] (7 species)
    not a true protein
  7. 2950712Species Synechococcus elongatus [TaxId:32046] [189889] (2 PDB entries)
  8. 2950713Domain d4affa1: 4aff A:1-112 [186745]
    Other proteins in same PDB: d4affa2
    automated match to d1qy7a_
    complexed with atp, flc, mg; mutant

Details for d4affa1

PDB Entry: 4aff (more details), 1.05 Å

PDB Description: High resolution structure of a PII mutant (I86N) protein in complex with ATP, MG and FLC
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4affa1:

Sequence, based on SEQRES records: (download)

>d4affa1 d.58.5.1 (A:1-112) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgengdgkifvspvdqtirirtgeknadai

Sequence, based on observed residues (ATOM records): (download)

>d4affa1 d.58.5.1 (A:1-112) automated matches {Synechococcus elongatus [TaxId: 32046]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkrgseytveflqklkleivve
daqvdtvidkivaaartgengdgkifvspvdqtirirtgeknadai

SCOPe Domain Coordinates for d4affa1:

Click to download the PDB-style file with coordinates for d4affa1.
(The format of our PDB-style files is described here.)

Timeline for d4affa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4affa2