SCOPe 2.02: Domain d4a9ka_: 4a9k A:

Lineage for d4a9ka_ (4a9k A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (9 PDB entries)

8. Domain d4a9ka_: 4a9k A: [186740]
   automated match to d1jspb_
   complexed with edo, k, scn, tyl

Details for d4a9ka_

PDB Entry: 4a9k, 1.81 Å

PDB Description: bromodomain of human crebbp with n-(4-hydroxyphenyl)acetamide

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d4a9ka_:

Sequence; same for both SEQRES and ATOM records:

>d4a9ka_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d4a9ka_:

• d4a9ka_ first appeared in SCOPe 2.01
  
• d4a9ka_ appears in SCOPe 2.03
  
• d4a9ka_ appears in the current release, SCOPe 2.08