Lineage for d4a91a_ (4a91 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105415Protein Glutamyl-Q tRNA-Asp synthetase YadB [102257] (1 species)
    truncated GluRS and GlnRS homologue lacking the anticodon-binding domain; glutamylates the modified base queuosine (Q) of tRNA-Asp
  7. 2105416Species Escherichia coli [TaxId:562] [102258] (3 PDB entries)
  8. 2105418Domain d4a91a_: 4a91 A: [186739]
    automated match to d1nzja_
    protein/RNA complex; complexed with glu, zn

Details for d4a91a_

PDB Entry: 4a91 (more details), 1.75 Å

PDB Description: crystal structure of the glutamyl-queuosine trnaasp synthetase from e. coli complexed with l-glutamate
PDB Compounds: (A:) glutamyl-q tRNA(asp) synthetase

SCOPe Domain Sequences for d4a91a_:

Sequence, based on SEQRES records: (download)

>d4a91a_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]}
dtqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilr
qlehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvl
hhgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhf
qgvteivrgadlieptvrqislyqlfgwkvpdyihlplalnpqgaklskqnhapalpkgd
prpvliaalqflgqqaeahwqdfsveqilqsavknwrltavpesaivnstfs

Sequence, based on observed residues (ATOM records): (download)

>d4a91a_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]}
dtqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilr
qlehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvl
hhgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhf
qgvteivrgadlieptvrqislyqlfgwkvpdyihlplalnpqgaklskqapalpkgdpr
pvliaalqflgqqaeahwqdfsveqilqsavknwrltavpesaivnstfs

SCOPe Domain Coordinates for d4a91a_:

Click to download the PDB-style file with coordinates for d4a91a_.
(The format of our PDB-style files is described here.)

Timeline for d4a91a_: