Lineage for d4a8ia_ (4a8i A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1825255Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1825306Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1825507Protein automated matches [190298] (1 species)
    not a true protein
  7. 1825508Species Streptomyces rubiginosus [TaxId:1929] [187248] (15 PDB entries)
  8. 1825511Domain d4a8ia_: 4a8i A: [186736]
    automated match to d1dxia_
    complexed with co, edo

Details for d4a8ia_

PDB Entry: 4a8i (more details), 0.95 Å

PDB Description: protein crystallization and microgravity: glucose isomerase crystals grown during the pcdf-protein mission
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d4a8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a8ia_ c.1.15.3 (A:) automated matches {Streptomyces rubiginosus [TaxId: 1929]}
nyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d4a8ia_:

Click to download the PDB-style file with coordinates for d4a8ia_.
(The format of our PDB-style files is described here.)

Timeline for d4a8ia_: