Lineage for d4a7ja_ (4a7j A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1135268Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1135354Superfamily b.69.4: WD40 repeat-like [50978] (3 families) (S)
    also contains 8-bladed propellers
  5. 1135470Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 1135471Protein automated matches [190568] (2 species)
    not a true protein
  7. 1135472Species Human (Homo sapiens) [TaxId:9606] [187559] (26 PDB entries)
  8. 1135491Domain d4a7ja_: 4a7j A: [186735]
    automated match to d1vyhc1

Details for d4a7ja_

PDB Entry: 4a7j (more details), 1.9 Å

PDB Description: Symmetric Dimethylation of H3 Arginine 2 is a Novel Histone Mark that Supports Euchromatin Maintenance
PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d4a7ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a7ja_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgis
dvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfde
svriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktlid
ddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtgg
kwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklwk
sdc

SCOPe Domain Coordinates for d4a7ja_:

Click to download the PDB-style file with coordinates for d4a7ja_.
(The format of our PDB-style files is described here.)

Timeline for d4a7ja_: