Lineage for d7atja_ (7atj A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99645Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 99646Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 99647Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 99761Protein Plant peroxidase [48125] (6 species)
  7. 99764Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (5 PDB entries)
  8. 99765Domain d7atja_: 7atj A: [18673]

Details for d7atja_

PDB Entry: 7atj (more details), 1.47 Å

PDB Description: recombinant horseradish peroxidase c1a complex with cyanide and ferulic acid

SCOP Domain Sequences for d7atja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7atja_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvn

SCOP Domain Coordinates for d7atja_:

Click to download the PDB-style file with coordinates for d7atja_.
(The format of our PDB-style files is described here.)

Timeline for d7atja_: