Lineage for d7atja_ (7atj A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) 
Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins) Protein Plant peroxidase [48125] (6 species) 
Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (5 PDB entries) 
Domain d7atja_: 7atj A: [18673]
Details for d7atja_
PDB Entry: 7atj (more details), 1.47 Å
PDB Description: recombinant horseradish peroxidase c1a complex with cyanide and ferulic acid
SCOP Domain Sequences for d7atja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7atja_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvn
SCOP Domain Coordinates for d7atja_:
Click to download the PDB-style file with coordinates for d7atja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7atja_:
- d7atja_ appears in SCOP 1.57
- d7atja_ appears in the current release, SCOPe 2.08
View in 3D