Lineage for d7atja_ (7atj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720260Protein Plant peroxidase [48125] (6 species)
  7. 2720263Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)
  8. 2720281Domain d7atja_: 7atj A: [18673]
    complexed with ca, cyn, fer, hem

Details for d7atja_

PDB Entry: 7atj (more details), 1.47 Å

PDB Description: recombinant horseradish peroxidase c1a complex with cyanide and ferulic acid
PDB Compounds: (A:) peroxidase c1a

SCOPe Domain Sequences for d7atja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7atja_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvn

SCOPe Domain Coordinates for d7atja_:

Click to download the PDB-style file with coordinates for d7atja_.
(The format of our PDB-style files is described here.)

Timeline for d7atja_: