SCOPe 2.06: Domain d4a6lb_: 4a6l B:

Lineage for d4a6lb_ (4a6l B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (20 PDB entries)

8. Domain d4a6lb_: 4a6l B: [186729]
   automated match to d1a0la_
   complexed with p43

Details for d4a6lb_

PDB Entry: 4a6l, 2.05 Å

PDB Description: beta-tryptase inhibitor

PDB Compounds: (B:) tryptase alpha/beta-1

SCOPe Domain Sequences for d4a6lb_:

Sequence; same for both SEQRES and ATOM records:

>d4a6lb_ b.47.1.2 (B:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d4a6lb_:

• d4a6lb_ first appeared in SCOPe 2.01
  
• d4a6lb_ appears in SCOPe 2.05
  
• d4a6lb_ appears in SCOPe 2.07
  
• d4a6lb_ appears in the current release, SCOPe 2.08