Lineage for d4a6la_ (4a6l A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953286Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 953287Species Human (Homo sapiens) [TaxId:9606] [50547] (12 PDB entries)
  8. 953288Domain d4a6la_: 4a6l A: [186728]
    automated match to d1a0la_
    complexed with p43

Details for d4a6la_

PDB Entry: 4a6l (more details), 2.05 Å

PDB Description: beta-tryptase inhibitor
PDB Compounds: (A:) tryptase alpha/beta-1

SCOPe Domain Sequences for d4a6la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6la_ b.47.1.2 (A:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d4a6la_:

Click to download the PDB-style file with coordinates for d4a6la_.
(The format of our PDB-style files is described here.)

Timeline for d4a6la_: