Lineage for d4a63k_ (4a63 K:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1772172Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1772173Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1772265Protein automated matches [190198] (2 species)
    not a true protein
  7. 1772266Species Human (Homo sapiens) [TaxId:9606] [186941] (47 PDB entries)
  8. 1772357Domain d4a63k_: 4a63 K: [186727]
    Other proteins in same PDB: d4a63b1, d4a63b2, d4a63d1, d4a63d2, d4a63f1, d4a63f2, d4a63h1, d4a63h2, d4a63j1, d4a63j2, d4a63l1, d4a63l2
    automated match to d1gzha_
    complexed with act, zn

Details for d4a63k_

PDB Entry: 4a63 (more details), 2.27 Å

PDB Description: crystal structure of the p73-aspp2 complex at 2.6a resolution
PDB Compounds: (K:) tumour protein 73

SCOPe Domain Sequences for d4a63k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a63k_ b.2.5.2 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
icacpgrdrkadedhyreaenlyfq

SCOPe Domain Coordinates for d4a63k_:

Click to download the PDB-style file with coordinates for d4a63k_.
(The format of our PDB-style files is described here.)

Timeline for d4a63k_: