![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
![]() | Protein automated matches [190198] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries) |
![]() | Domain d4a63g1: 4a63 G:114-311 [186725] Other proteins in same PDB: d4a63a2, d4a63b1, d4a63b2, d4a63c2, d4a63d1, d4a63d2, d4a63e2, d4a63f1, d4a63f2, d4a63g2, d4a63h1, d4a63h2, d4a63i2, d4a63j1, d4a63j2, d4a63k2, d4a63l1, d4a63l2 automated match to d1gzha_ complexed with act, zn |
PDB Entry: 4a63 (more details), 2.27 Å
SCOPe Domain Sequences for d4a63g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a63g1 b.2.5.2 (G:114-311) automated matches {Human (Homo sapiens) [TaxId: 9606]} vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr icacpgrdrkadedhyre
Timeline for d4a63g1: