Lineage for d4a63e1 (4a63 E:114-311)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2040932Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2041041Protein automated matches [190198] (2 species)
    not a true protein
  7. 2041042Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2041137Domain d4a63e1: 4a63 E:114-311 [186724]
    Other proteins in same PDB: d4a63a2, d4a63b1, d4a63b2, d4a63c2, d4a63d1, d4a63d2, d4a63e2, d4a63f1, d4a63f2, d4a63g2, d4a63h1, d4a63h2, d4a63i2, d4a63j1, d4a63j2, d4a63k2, d4a63l1, d4a63l2
    automated match to d1gzha_
    complexed with act, zn

Details for d4a63e1

PDB Entry: 4a63 (more details), 2.27 Å

PDB Description: crystal structure of the p73-aspp2 complex at 2.6a resolution
PDB Compounds: (E:) tumour protein 73

SCOPe Domain Sequences for d4a63e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a63e1 b.2.5.2 (E:114-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
icacpgrdrkadedhyre

SCOPe Domain Coordinates for d4a63e1:

Click to download the PDB-style file with coordinates for d4a63e1.
(The format of our PDB-style files is described here.)

Timeline for d4a63e1: