SCOPe 2.04: Domain d4a63e_: 4a63 E:

Lineage for d4a63e_ (4a63 E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (39 PDB entries)

8. Domain d4a63e_: 4a63 E: [186724]
   Other proteins in same PDB: d4a63b1, d4a63b2, d4a63d1, d4a63d2, d4a63f1, d4a63f2, d4a63h1, d4a63h2, d4a63j1, d4a63j2, d4a63l1, d4a63l2
   automated match to d1gzha_
   complexed with act, zn

Details for d4a63e_

PDB Entry: 4a63, 2.27 Å

PDB Description: crystal structure of the p73-aspp2 complex at 2.6a resolution

PDB Compounds: (E:) tumour protein 73

SCOPe Domain Sequences for d4a63e_:

Sequence; same for both SEQRES and ATOM records:

>d4a63e_ b.2.5.2 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
icacpgrdrkadedhyreaenlyfq

Timeline for d4a63e_:

• d4a63e_ first appeared in SCOPe 2.01
  
• d4a63e_ appears in SCOPe 2.03
  
• d4a63e_ appears in SCOPe 2.05
  
• d4a63e_ appears in the current release, SCOPe 2.08, called d4a63e1