Lineage for d4a63c_ (4a63 C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938790Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 938791Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 938859Protein automated matches [190198] (2 species)
    not a true protein
  7. 938860Species Human (Homo sapiens) [TaxId:9606] [186941] (13 PDB entries)
  8. 938901Domain d4a63c_: 4a63 C: [186723]
    automated match to d1gzha_
    complexed with act, zn

Details for d4a63c_

PDB Entry: 4a63 (more details), 2.27 Å

PDB Description: crystal structure of the p73-aspp2 complex at 2.6a resolution
PDB Compounds: (C:) tumour protein 73

SCOPe Domain Sequences for d4a63c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a63c_ b.2.5.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgt
airampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgr
qsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegr
icacpgrdrkadedhyreaenlyfq

SCOPe Domain Coordinates for d4a63c_:

Click to download the PDB-style file with coordinates for d4a63c_.
(The format of our PDB-style files is described here.)

Timeline for d4a63c_: