SCOPe 2.01: Domain d4a4cc_: 4a4c C:

Lineage for d4a4cc_ (4a4c C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (10 PDB entries)
   Uniprot P62837
   E2-17 kDa 2

8. Domain d4a4cc_: 4a4c C: [186721]
   automated match to d1ur6a_
   complexed with ca, zn

Details for d4a4cc_

PDB Entry: 4a4c, 2.7 Å

PDB Description: structure of phosphotyr371-c-cbl-ubch5b-zap-70 complex

PDB Compounds: (C:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4a4cc_:

Sequence, based on SEQRES records:

>d4a4cc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

Sequence, based on observed residues (ATOM records):

>d4a4cc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariykdrekynriarewtqkyam

Timeline for d4a4cc_:

• d4a4cc_ is new in SCOPe 2.01-stable
  
• d4a4cc_ appears in SCOPe 2.02
  
• d4a4cc_ appears in the current release, SCOPe 2.08