Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (10 PDB entries) Uniprot P62837 E2-17 kDa 2 |
Domain d4a4cc_: 4a4c C: [186721] automated match to d1ur6a_ complexed with ca, zn |
PDB Entry: 4a4c (more details), 2.7 Å
SCOPe Domain Sequences for d4a4cc_:
Sequence, based on SEQRES records: (download)
>d4a4cc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]} alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp eiariyktdrekynriarewtqkyam
>d4a4cc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]} alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp eiariykdrekynriarewtqkyam
Timeline for d4a4cc_: