Lineage for d4a4bc_ (4a4b C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021593Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1021601Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1021698Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (10 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 1021705Domain d4a4bc_: 4a4b C: [186720]
    automated match to d1ur6a_
    complexed with ca, zn

Details for d4a4bc_

PDB Entry: 4a4b (more details), 2.79 Å

PDB Description: Structure of modified phosphoTyr371-c-Cbl-UbcH5B-ZAP-70 complex
PDB Compounds: (C:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4a4bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a4bc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d4a4bc_:

Click to download the PDB-style file with coordinates for d4a4bc_.
(The format of our PDB-style files is described here.)

Timeline for d4a4bc_: