Lineage for d1apxd_ (1apx D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49663Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 49664Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 49665Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 49666Protein Ascorbate peroxidase [48123] (1 species)
  7. 49667Species Pea (Pisum sativum) [TaxId:3888] [48124] (1 PDB entry)
  8. 49671Domain d1apxd_: 1apx D: [18672]

Details for d1apxd_

PDB Entry: 1apx (more details), 2.2 Å

PDB Description: crystal structure of recombinant ascorbate peroxidase

SCOP Domain Sequences for d1apxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apxd_ a.93.1.1 (D:) Ascorbate peroxidase {Pea (Pisum sativum)}
gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
lselgfaea

SCOP Domain Coordinates for d1apxd_:

Click to download the PDB-style file with coordinates for d1apxd_.
(The format of our PDB-style files is described here.)

Timeline for d1apxd_: