Lineage for d4a3na_ (4a3n A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909191Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 909192Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 909262Family a.21.1.0: automated matches [191668] (1 protein)
    not a true family
  6. 909263Protein automated matches [191268] (1 species)
    not a true protein
  7. 909264Species Human (Homo sapiens) [TaxId:9606] [189843] (1 PDB entry)
  8. 909265Domain d4a3na_: 4a3n A: [186718]
    automated match to d1gt0d_
    complexed with zn

Details for d4a3na_

PDB Entry: 4a3n (more details), 2.4 Å

PDB Description: Crystal Structure of HMG-BOX of Human SOX17
PDB Compounds: (A:) Transcription factor SOX-17

SCOPe Domain Sequences for d4a3na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a3na_ a.21.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpmnafmvwakderkrlaqqnpdlhnaelskmlgkswkaltlaekrpfveeaerlrvqhm
qdhpn

SCOPe Domain Coordinates for d4a3na_:

Click to download the PDB-style file with coordinates for d4a3na_.
(The format of our PDB-style files is described here.)

Timeline for d4a3na_: