Lineage for d1apxc_ (1apx C:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) 
Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins) 
Protein Ascorbate peroxidase [48123] (1 species) Species Pea (Pisum sativum) [TaxId:3888] [48124] (1 PDB entry) 
Domain d1apxc_: 1apx C: [18671]
Details for d1apxc_
PDB Entry: 1apx (more details), 2.2 Å
PDB Description: crystal structure of recombinant ascorbate peroxidase
SCOP Domain Sequences for d1apxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1apxc_ a.93.1.1 (C:) Ascorbate peroxidase {Pea (Pisum sativum)}
gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
lselgfaea
SCOP Domain Coordinates for d1apxc_:
Click to download the PDB-style file with coordinates for d1apxc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1apxc_:
- d1apxc_ appears in SCOP 1.57
- d1apxc_ appears in the current release, SCOPe 2.08
View in 3D
