| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.133: RbsD-like [102545] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest |
Superfamily c.133.1: RbsD-like [102546] (2 families) ![]() |
| Family c.133.1.0: automated matches [191558] (1 protein) not a true family |
| Protein automated matches [190962] (7 species) not a true protein |
| Species Streptococcus pneumoniae [TaxId:170187] [189744] (1 PDB entry) |
| Domain d4a34i_: 4a34 I: [186706] automated match to d2ob5a1 complexed with ful, k |
PDB Entry: 4a34 (more details), 2.5 Å
SCOPe Domain Sequences for d4a34i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a34i_ c.133.1.0 (I:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
vatgetslyaniilkkgvvver
Timeline for d4a34i_: