Lineage for d1apxb_ (1apx B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773243Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 773244Protein Ascorbate peroxidase [48123] (3 species)
  7. 773247Species Pea (Pisum sativum) [TaxId:3888] [48124] (1 PDB entry)
  8. 773249Domain d1apxb_: 1apx B: [18670]

Details for d1apxb_

PDB Entry: 1apx (more details), 2.2 Å

PDB Description: crystal structure of recombinant ascorbate peroxidase
PDB Compounds: (B:) cytosolic ascorbate peroxidase

SCOP Domain Sequences for d1apxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apxb_ a.93.1.1 (B:) Ascorbate peroxidase {Pea (Pisum sativum) [TaxId: 3888]}
gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
lselgfaea

SCOP Domain Coordinates for d1apxb_:

Click to download the PDB-style file with coordinates for d1apxb_.
(The format of our PDB-style files is described here.)

Timeline for d1apxb_: