Lineage for d4a34a_ (4a34 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1396484Fold c.133: RbsD-like [102545] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 251634; strand 6 is antiparallel to the rest
  4. 1396485Superfamily c.133.1: RbsD-like [102546] (2 families) (S)
  5. 1396512Family c.133.1.0: automated matches [191558] (1 protein)
    not a true family
  6. 1396513Protein automated matches [190962] (6 species)
    not a true protein
  7. 1396564Species Streptococcus pneumoniae [TaxId:170187] [189744] (1 PDB entry)
  8. 1396565Domain d4a34a_: 4a34 A: [186698]
    automated match to d2ob5a1
    complexed with ful, k

Details for d4a34a_

PDB Entry: 4a34 (more details), 2.5 Å

PDB Description: crystal structure of the fucose mutarotase in complex with l-fucose from streptococcus pneumoniae
PDB Compounds: (A:) rbsd/fucu transport protein family protein

SCOPe Domain Sequences for d4a34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a34a_ c.133.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
lkhipknispdllktlmemghgdeivladanypsascanklircdgvnipelldsilylm
pldsyvdssiqfmnvvsgddipkiwgtyrqmieghgtdlktitylrredfyerskkayai
vatgetslyaniilkkgvvv

SCOPe Domain Coordinates for d4a34a_:

Click to download the PDB-style file with coordinates for d4a34a_.
(The format of our PDB-style files is described here.)

Timeline for d4a34a_: