SCOPe 2.02: Domain d4a1wc_: 4a1w C:

Lineage for d4a1wc_ (4a1w C:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (20 PDB entries)

8. Domain d4a1wc_: 4a1w C: [186694]
   automated match to d1g5ja_

Details for d4a1wc_

PDB Entry: 4a1w, 2.5 Å

PDB Description: crystal structure of alpha-beta foldamer 4c in complex with bcl-xl

PDB Compounds: (C:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4a1wc_:

Sequence; same for both SEQRES and ATOM records:

>d4a1wc_ f.1.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitpgt
ayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhl
epwiqenggwdtfvelyg

Timeline for d4a1wc_:

• d4a1wc_ first appeared in SCOPe 2.01
  
• d4a1wc_ appears in SCOPe 2.03
  
• d4a1wc_ appears in the current release, SCOPe 2.08