Lineage for d1apxa_ (1apx A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99645Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 99646Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 99647Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 99648Protein Ascorbate peroxidase [48123] (1 species)
  7. 99649Species Pea (Pisum sativum) [TaxId:3888] [48124] (1 PDB entry)
  8. 99650Domain d1apxa_: 1apx A: [18669]

Details for d1apxa_

PDB Entry: 1apx (more details), 2.2 Å

PDB Description: crystal structure of recombinant ascorbate peroxidase

SCOP Domain Sequences for d1apxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apxa_ a.93.1.1 (A:) Ascorbate peroxidase {Pea (Pisum sativum)}
gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
lselgfaea

SCOP Domain Coordinates for d1apxa_:

Click to download the PDB-style file with coordinates for d1apxa_.
(The format of our PDB-style files is described here.)

Timeline for d1apxa_: