Lineage for d4a0qb_ (4a0q B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468413Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2468414Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2468415Family c.62.1.1: Integrin A (or I) domain [53301] (12 protein domains)
  6. 2468566Protein automated matches [190060] (2 species)
    not a true protein
  7. 2468569Species Human (Homo sapiens) [TaxId:9606] [186779] (13 PDB entries)
  8. 2468577Domain d4a0qb_: 4a0q B: [186689]
    automated match to d1pt6b_
    complexed with mg; mutant

Details for d4a0qb_

PDB Entry: 4a0q (more details), 1.9 Å

PDB Description: Activated Conformation of Integrin alpha1 I-Domain mutant
PDB Compounds: (B:) integrin alpha-1

SCOPe Domain Sequences for d4a0qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a0qb_ c.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
teevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhr
lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdalalv
tivktlgerifa

SCOPe Domain Coordinates for d4a0qb_:

Click to download the PDB-style file with coordinates for d4a0qb_.
(The format of our PDB-style files is described here.)

Timeline for d4a0qb_: