Lineage for d4a0qa_ (4a0q A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128912Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128913Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2128914Family c.62.1.1: Integrin A (or I) domain [53301] (11 protein domains)
  6. 2129056Protein automated matches [190060] (1 species)
    not a true protein
  7. 2129057Species Human (Homo sapiens) [TaxId:9606] [186779] (13 PDB entries)
  8. 2129064Domain d4a0qa_: 4a0q A: [186688]
    automated match to d1pt6b_
    complexed with mg; mutant

Details for d4a0qa_

PDB Entry: 4a0q (more details), 1.9 Å

PDB Description: Activated Conformation of Integrin alpha1 I-Domain mutant
PDB Compounds: (A:) integrin alpha-1

SCOPe Domain Sequences for d4a0qa_:

Sequence, based on SEQRES records: (download)

>d4a0qa_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
teevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhr
lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdalalv
tivktlgerifa

Sequence, based on observed residues (ATOM records): (download)

>d4a0qa_ c.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
teevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhr
lkkviqdcedeniqrfsiailgsystekfveeiksiaseptekhffnvsdalalvtivkt
lgerifa

SCOPe Domain Coordinates for d4a0qa_:

Click to download the PDB-style file with coordinates for d4a0qa_.
(The format of our PDB-style files is described here.)

Timeline for d4a0qa_: