SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3zzlc_ (3zzl C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2071633Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 2071634Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 protein domains)
    oligomeric ring consists of 11 single-domain subunits
    automatically mapped to Pfam PF02081
  6. 2071818Protein automated matches [191248] (4 species)
    not a true protein
  7. 2071819Species Bacillus halodurans [TaxId:86665] [189759] (1 PDB entry)
  8. 2071822Domain d3zzlc_: 3zzl C: [186669]
    automated match to d1wapa_
    complexed with trp

Details for d3zzlc_

PDB Entry: 3zzl (more details), 1.67 Å

PDB Description: bacillus halodurans trp rna-binding attenuation protein (trap): a 12-subunit assembly
PDB Compounds: (C:) transcription attenuation protein mtrb

SCOPe Domain Sequences for d3zzlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zzlc_ b.82.5.1 (C:) automated matches {Bacillus halodurans [TaxId: 86665]}
snffvikakengvnvfgmtrgtdtrfhhsekldkgevmiaqftehtsavkirgkaiiqts
ygtldtekde

SCOPe Domain Coordinates for d3zzlc_:

Click to download the PDB-style file with coordinates for d3zzlc_.
(The format of our PDB-style files is described here.)

Timeline for d3zzlc_: