Lineage for d3zyrb_ (3zyr B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042900Species Platypodium elegans [TaxId:115002] [189870] (3 PDB entries)
  8. 2042902Domain d3zyrb_: 3zyr B: [186662]
    automated match to d1n3oa_
    complexed with asn, ca, gol, mn, ure

Details for d3zyrb_

PDB Entry: 3zyr (more details), 1.65 Å

PDB Description: Structure of the lectin from Platypodium elegans in complex with heptasaccharide
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d3zyrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zyrb_ b.29.1.1 (B:) automated matches {Platypodium elegans [TaxId: 115002]}
stdslsfsfinfdrdernlifqgdahtsrnnilqltrtdsngapvrstvgrilhsaqvrl
wekstnrvanlqtqfsfflssplsnpadgiaffiappdttipsgsaggllglfnprtaln
esanqvlavefdtffaqnsntwdpnyqhigidvnsirsskvvrwerregktlnvlvtynp
strtidvvatypdgqryqlshvvdlttilpewvrvgfsaasgeqfqthnleswsftstll
y

SCOPe Domain Coordinates for d3zyrb_:

Click to download the PDB-style file with coordinates for d3zyrb_.
(The format of our PDB-style files is described here.)

Timeline for d3zyrb_: