SCOPe 2.05: Domain d3zyra_: 3zyr A:

Lineage for d3zyra_ (3zyr A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (21 species)
   not a true protein

7. Species Platypodium elegans [TaxId:115002] [189870] (2 PDB entries)

8. Domain d3zyra_: 3zyr A: [186661]
   automated match to d1n3oa_
   complexed with asn, ca, gol, mn, ure

Details for d3zyra_

PDB Entry: 3zyr, 1.65 Å

PDB Description: structure of the lectin from platypodium elegans in complex with heptasaccharide

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d3zyra_:

Sequence; same for both SEQRES and ATOM records:

>d3zyra_ b.29.1.1 (A:) automated matches {Platypodium elegans [TaxId: 115002]}
stdslsfsfinfdrdernlifqgdahtsrnnilqltrtdsngapvrstvgrilhsaqvrl
wekstnrvanlqtqfsfflssplsnpadgiaffiappdttipsgsaggllglfnprtaln
esanqvlavefdtffaqnsntwdpnyqhigidvnsirsskvvrwerregktlnvlvtynp
strtidvvatypdgqryqlshvvdlttilpewvrvgfsaasgeqfqthnleswsftstll

Timeline for d3zyra_:

• d3zyra_ first appeared in SCOPe 2.01
  
• d3zyra_ appears in SCOPe 2.04
  
• d3zyra_ appears in SCOPe 2.06
  
• d3zyra_ appears in the current release, SCOPe 2.08