Lineage for d3zxia_ (3zxi A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106130Species Human (Homo sapiens) [TaxId:9606] [188230] (4 PDB entries)
  8. 2106135Domain d3zxia_: 3zxi A: [186656]
    automated match to d1tyae_
    protein/RNA complex; complexed with tya

Details for d3zxia_

PDB Entry: 3zxi (more details), 2.75 Å

PDB Description: crystal structure of human mitochondrial tyrosyl-trna synthetase in complex with a tyrosyl-adenylate analog
PDB Compounds: (A:) tyrosyl-tRNA synthetase, mitochondrial

SCOPe Domain Sequences for d3zxia_:

Sequence, based on SEQRES records: (download)

>d3zxia_ c.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gllaaqkarglfkdffpetgtkielpelfdrgtasfpqtiycgfdptadslhvghllall
glfhlqraghnvialvggatarlgdpsgrtkerealetervranaralrlglealaanhq
qlftdgrswgsftvldnsawyqkqhlvdflaavgghfrmgtllsrqsvqlrlkspegmsl
aeffyqvlqaydfyylfqrygcrvqlggsdqlgnimsgyefinkltgedvfgitvplits
ttgaklgksagnavwlnrdktspfelyqffvrqpddsverylklftflplpeidhimqlh
vkeperrgpqkrlaaevtklvhgregldsakrctqaly

Sequence, based on observed residues (ATOM records): (download)

>d3zxia_ c.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gllaaqkarglfkdffppqtiycgfdptadslhvghllallglfhlqraghnvialvgga
tarlgdpsgrtkerealetervranaralrlglealaanhqqlftdgrswgsftvldnsa
wyqkqhlvdflaavgghfrmgtllsrqsvqlrlkspegmslaeffyqvlqaydfyylfqr
ygcrvqlggsdqlgnimsgyefinkltgedvfgitvplitavwlnrdktspfelyqffvr
qpddsverylklftflplpeidhimqlhvkeperrgpqkrlaaevtklvhgregldsakr
ctqaly

SCOPe Domain Coordinates for d3zxia_:

Click to download the PDB-style file with coordinates for d3zxia_.
(The format of our PDB-style files is described here.)

Timeline for d3zxia_: