Lineage for d3zxfb_ (3zxf B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1780718Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 protein domains)
  6. 1780890Protein automated matches [190029] (5 species)
    not a true protein
  7. 1780898Species Human (Homo sapiens) [TaxId:9606] [186749] (8 PDB entries)
  8. 1780900Domain d3zxfb_: 3zxf B: [186653]
    automated match to d1bkza_
    complexed with act

Details for d3zxfb_

PDB Entry: 3zxf (more details), 1.38 Å

PDB Description: High resolution structure of Human Galectin-7
PDB Compounds: (B:) galectin-7

SCOPe Domain Sequences for d3zxfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxfb_ b.29.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pamsnvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldts
evvfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplar
vrlvevggdvqldsvrif

SCOPe Domain Coordinates for d3zxfb_:

Click to download the PDB-style file with coordinates for d3zxfb_.
(The format of our PDB-style files is described here.)

Timeline for d3zxfb_: