SCOPe 2.08: Domain d3zxfb1: 3zxf B:0-135

Lineage for d3zxfb1 (3zxf B:0-135)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)

8. Domain d3zxfb1: 3zxf B:0-135 [186653]
   Other proteins in same PDB: d3zxfb2
   automated match to d1bkza_
   complexed with act

Details for d3zxfb1

PDB Entry: 3zxf, 1.38 Å

PDB Description: High resolution structure of Human Galectin-7

PDB Compounds: (B:) galectin-7

SCOPe Domain Sequences for d3zxfb1:

Sequence; same for both SEQRES and ATOM records:

>d3zxfb1 b.29.1.3 (B:0-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsev
vfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvr
lvevggdvqldsvrif

Timeline for d3zxfb1:

• d3zxfb1 first appeared in SCOPe 2.01, called d3zxfb_
  
• d3zxfb1 appears in SCOPe 2.07