Lineage for d3zxfb1 (3zxf B:0-135)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779456Protein automated matches [190029] (6 species)
    not a true protein
  7. 2779464Species Human (Homo sapiens) [TaxId:9606] [186749] (38 PDB entries)
  8. 2779466Domain d3zxfb1: 3zxf B:0-135 [186653]
    Other proteins in same PDB: d3zxfb2
    automated match to d1bkza_
    complexed with act

Details for d3zxfb1

PDB Entry: 3zxf (more details), 1.38 Å

PDB Description: High resolution structure of Human Galectin-7
PDB Compounds: (B:) galectin-7

SCOPe Domain Sequences for d3zxfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxfb1 b.29.1.3 (B:0-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsev
vfnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvr
lvevggdvqldsvrif

SCOPe Domain Coordinates for d3zxfb1:

Click to download the PDB-style file with coordinates for d3zxfb1.
(The format of our PDB-style files is described here.)

Timeline for d3zxfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zxfb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3zxfa_