SCOPe 2.05: Domain d3zxfa_: 3zxf A:

Lineage for d3zxfa_ (3zxf A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186749] (8 PDB entries)

8. Domain d3zxfa_: 3zxf A: [186652]
   automated match to d1bkza_
   complexed with act

Details for d3zxfa_

PDB Entry: 3zxf, 1.38 Å

PDB Description: High resolution structure of Human Galectin-7

PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d3zxfa_:

Sequence; same for both SEQRES and ATOM records:

>d3zxfa_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

Timeline for d3zxfa_:

• d3zxfa_ first appeared in SCOPe 2.01
  
• d3zxfa_ appears in SCOPe 2.04
  
• d3zxfa_ appears in SCOPe 2.06
  
• d3zxfa_ appears in the current release, SCOPe 2.08