Lineage for d3zxfa_ (3zxf A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373886Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2374079Protein automated matches [190029] (5 species)
    not a true protein
  7. 2374087Species Human (Homo sapiens) [TaxId:9606] [186749] (20 PDB entries)
  8. 2374088Domain d3zxfa_: 3zxf A: [186652]
    Other proteins in same PDB: d3zxfb2
    automated match to d1bkza_
    complexed with act

Details for d3zxfa_

PDB Entry: 3zxf (more details), 1.38 Å

PDB Description: High resolution structure of Human Galectin-7
PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d3zxfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxfa_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snvphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevv
fnskeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrl
vevggdvqldsvrif

SCOPe Domain Coordinates for d3zxfa_:

Click to download the PDB-style file with coordinates for d3zxfa_.
(The format of our PDB-style files is described here.)

Timeline for d3zxfa_: