SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3zwpg_ (3zwp G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103986Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2104030Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 protein domains)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2104155Protein automated matches [191078] (1 species)
    not a true protein
  7. 2104156Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (12 PDB entries)
  8. 2104219Domain d3zwpg_: 3zwp G: [186632]
    Other proteins in same PDB: d3zwpb2, d3zwpf2
    automated match to d1r12a_
    complexed with avu, gol

Details for d3zwpg_

PDB Entry: 3zwp (more details), 2.11 Å

PDB Description: crystal structure of adp ribosyl cyclase complexed with ara- 2'f-adp-ribose at 2.1 angstrom
PDB Compounds: (G:) ADP-ribosyl cyclase

SCOPe Domain Sequences for d3zwpg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zwpg_ c.23.14.3 (G:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrla

SCOPe Domain Coordinates for d3zwpg_:

Click to download the PDB-style file with coordinates for d3zwpg_.
(The format of our PDB-style files is described here.)

Timeline for d3zwpg_: