Lineage for d3zwpb_ (3zwp B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 983822Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 983863Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
  6. 983969Protein automated matches [191078] (1 species)
    not a true protein
  7. 983970Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (9 PDB entries)
  8. 983986Domain d3zwpb_: 3zwp B: [186627]
    automated match to d1r12a_
    complexed with avu, gol

Details for d3zwpb_

PDB Entry: 3zwp (more details), 2.11 Å

PDB Description: crystal structure of adp ribosyl cyclase complexed with ara- 2'f-adp-ribose at 2.1 angstrom
PDB Compounds: (B:) ADP-ribosyl cyclase

SCOPe Domain Sequences for d3zwpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zwpb_ c.23.14.3 (B:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
aaivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsy
kdfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranp
gfnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgky
elpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfll
csdnpnarecrla

SCOPe Domain Coordinates for d3zwpb_:

Click to download the PDB-style file with coordinates for d3zwpb_.
(The format of our PDB-style files is described here.)

Timeline for d3zwpb_: