Lineage for d3zwod_ (3zwo D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858401Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2858445Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2858579Protein automated matches [191078] (1 species)
    not a true protein
  7. 2858580Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (12 PDB entries)
  8. 2858590Domain d3zwod_: 3zwo D: [186621]
    automated match to d1r0sa_
    complexed with g2q, ngd

Details for d3zwod_

PDB Entry: 3zwo (more details), 2 Å

PDB Description: Crystal structure of ADP ribosyl cyclase complexed with reaction intermediate
PDB Compounds: (D:) ADP-ribosyl cyclase

SCOPe Domain Sequences for d3zwod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zwod_ c.23.14.3 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrla

SCOPe Domain Coordinates for d3zwod_:

Click to download the PDB-style file with coordinates for d3zwod_.
(The format of our PDB-style files is described here.)

Timeline for d3zwod_: