| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
| Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins) contains extra N-terminal all-alpha subdomain automatically mapped to Pfam PF02267 |
| Protein automated matches [191078] (1 species) not a true protein |
| Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (12 PDB entries) |
| Domain d3zwod_: 3zwo D: [186621] automated match to d1r0sa_ complexed with g2q, ngd |
PDB Entry: 3zwo (more details), 2 Å
SCOPe Domain Sequences for d3zwod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zwod_ c.23.14.3 (D:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrla
Timeline for d3zwod_: