Lineage for d3zwnb_ (3zwn B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840000Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 1840044Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 1840167Protein automated matches [191078] (1 species)
    not a true protein
  7. 1840168Species California sea hare (Aplysia californica) [TaxId:6500] [189008] (12 PDB entries)
  8. 1840174Domain d3zwnb_: 3zwn B: [186617]
    automated match to d1r12a_
    complexed with cgr, ngd

Details for d3zwnb_

PDB Entry: 3zwn (more details), 1.8 Å

PDB Description: Crystal structure of Aplysia cyclase complexed with substrate NGD and product cGDPR
PDB Compounds: (B:) ADP-ribosyl cyclase

SCOPe Domain Sequences for d3zwnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zwnb_ c.23.14.3 (B:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
aivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsyk
dfftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpg
fnekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkye
lpnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllc
sdnpnarecrla

SCOPe Domain Coordinates for d3zwnb_:

Click to download the PDB-style file with coordinates for d3zwnb_.
(The format of our PDB-style files is described here.)

Timeline for d3zwnb_: