Lineage for d3zvzb_ (3zvz B:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967224Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1967225Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1967322Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 1967323Protein automated matches [190772] (5 species)
    not a true protein
  7. 1967326Species Human (Homo sapiens) [TaxId:9606] [187998] (20 PDB entries)
  8. 1967329Domain d3zvzb_: 3zvz B: [186607]
    automated match to d1f62a_
    complexed with zn

Details for d3zvzb_

PDB Entry: 3zvz (more details), 1.44 Å

PDB Description: phd finger of human uhrf1
PDB Compounds: (B:) E3 ubiquitin-protein ligase UHRF1

SCOPe Domain Sequences for d3zvzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zvzb_ g.50.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghmrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedewycpecrn

SCOPe Domain Coordinates for d3zvzb_:

Click to download the PDB-style file with coordinates for d3zvzb_.
(The format of our PDB-style files is described here.)

Timeline for d3zvzb_: