![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
![]() | Protein automated matches [190772] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187998] (20 PDB entries) |
![]() | Domain d3zvzb_: 3zvz B: [186607] automated match to d1f62a_ complexed with zn |
PDB Entry: 3zvz (more details), 1.44 Å
SCOPe Domain Sequences for d3zvzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zvzb_ g.50.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ghmrvcachlcggrqdpdkqlmcdecdmafhiycldpplssvpsedewycpecrn
Timeline for d3zvzb_: