SCOPe 2.08: Domain d3zvxb_: 3zvx B:

Lineage for d3zvxb_ (3zvx B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (28 species)
   not a true protein

7. Species Platypodium elegans [TaxId:115002] [189870] (3 PDB entries)

8. Domain d3zvxb_: 3zvx B: [186606]
   automated match to d1n3oa_
   complexed with ca, gol, mn, so4

Details for d3zvxb_

PDB Entry: 3zvx, 2.1 Å

PDB Description: structure of the lectin from platypodium elegans in complex with a trimannoside

PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d3zvxb_:

Sequence; same for both SEQRES and ATOM records:

>d3zvxb_ b.29.1.1 (B:) automated matches {Platypodium elegans [TaxId: 115002]}
tdslsfsfinfdrdernlifqgdahtsrnnilqltrtdsngapvrstvgrilhsaqvrlw
ekstnrvanlqtqfsfflssplsnpadgiaffiappdttipsgsaggllglfnprtalne
sanqvlavefdtffaqnsntwdpnyqhigidvnsirsskvvrwerregktlnvlvtynps
trtidvvatypdgqryqlshvvdlttilpewvrvgfsaasgeqfqthnleswsftstlly
t

Timeline for d3zvxb_:

• d3zvxb_ first appeared in SCOPe 2.01
  
• d3zvxb_ appears in SCOPe 2.07