Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (27 species) not a true protein |
Species Platypodium elegans [TaxId:115002] [189870] (3 PDB entries) |
Domain d3zvxa_: 3zvx A: [186605] automated match to d1n3oa_ complexed with ca, gol, mn, so4 |
PDB Entry: 3zvx (more details), 2.1 Å
SCOPe Domain Sequences for d3zvxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zvxa_ b.29.1.1 (A:) automated matches {Platypodium elegans [TaxId: 115002]} stdslsfsfinfdrdernlifqgdahtsrnnilqltrtdsngapvrstvgrilhsaqvrl wekstnrvanlqtqfsfflssplsnpadgiaffiappdttipsgsaggllglfnprtaln esanqvlavefdtffaqnsntwdpnyqhigidvnsirsskvvrwerregktlnvlvtynp strtidvvatypdgqryqlshvvdlttilpewvrvgfsaasgeqfqthnleswsftstll yt
Timeline for d3zvxa_: