Lineage for d3zvxa_ (3zvx A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2049734Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2050278Protein automated matches [190035] (27 species)
    not a true protein
  7. 2050458Species Platypodium elegans [TaxId:115002] [189870] (3 PDB entries)
  8. 2050462Domain d3zvxa_: 3zvx A: [186605]
    automated match to d1n3oa_
    complexed with ca, gol, mn, so4

Details for d3zvxa_

PDB Entry: 3zvx (more details), 2.1 Å

PDB Description: structure of the lectin from platypodium elegans in complex with a trimannoside
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d3zvxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zvxa_ b.29.1.1 (A:) automated matches {Platypodium elegans [TaxId: 115002]}
stdslsfsfinfdrdernlifqgdahtsrnnilqltrtdsngapvrstvgrilhsaqvrl
wekstnrvanlqtqfsfflssplsnpadgiaffiappdttipsgsaggllglfnprtaln
esanqvlavefdtffaqnsntwdpnyqhigidvnsirsskvvrwerregktlnvlvtynp
strtidvvatypdgqryqlshvvdlttilpewvrvgfsaasgeqfqthnleswsftstll
yt

SCOPe Domain Coordinates for d3zvxa_:

Click to download the PDB-style file with coordinates for d3zvxa_.
(The format of our PDB-style files is described here.)

Timeline for d3zvxa_: