Lineage for d3zv3b_ (3zv3 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 976463Protein automated matches [190085] (29 species)
    not a true protein
  7. 976581Species Pandoraea pnomenusa [TaxId:93220] [189780] (3 PDB entries)
  8. 976587Domain d3zv3b_: 3zv3 B: [186598]
    automated match to d1bdba_

Details for d3zv3b_

PDB Entry: 3zv3 (more details), 2.9 Å

PDB Description: crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356 in intermediate state of substrate binding loop
PDB Compounds: (B:) cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase

SCOPe Domain Sequences for d3zv3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zv3b_ c.2.1.2 (B:) automated matches {Pandoraea pnomenusa [TaxId: 93220]}
mkltgevalitggasglgralvdrfvaegarvavldksaerlrelevahggnavgvvgdv
rslqdqkraaerclaafgkidtlipnagiwdystaladlpedkidaafddifhvnvkgyi
havkaclpalvssrgsvvftisnagfypngggplytatkhavvglvrqmafelaphvrvn
gvapggmntdlrgpsslglseqsissvpladmlksvlpigrmpaleeytgayvffatrgd
slpatgallnydggmgvrgfltaaggadlpeklnin

SCOPe Domain Coordinates for d3zv3b_:

Click to download the PDB-style file with coordinates for d3zv3b_.
(The format of our PDB-style files is described here.)

Timeline for d3zv3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3zv3a_