Lineage for d3zule_ (3zul E:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199567Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1199568Protein automated matches [190526] (11 species)
    not a true protein
  7. 1199591Species Echinophyllia sp. [TaxId:301887] [188534] (8 PDB entries)
  8. 1199624Domain d3zule_: 3zul E: [186591]
    automated match to d1mova_

Details for d3zule_

PDB Entry: 3zul (more details), 2.3 Å

PDB Description: padron on (fluorescent) icis intermediate state
PDB Compounds: (E:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d3zule_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zule_ d.22.1.0 (E:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs

SCOPe Domain Coordinates for d3zule_:

Click to download the PDB-style file with coordinates for d3zule_.
(The format of our PDB-style files is described here.)

Timeline for d3zule_: