Lineage for d3zulc_ (3zul C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1022370Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1022371Protein automated matches [190526] (7 species)
    not a true protein
  7. 1022391Species Echinophyllia sp. [TaxId:301887] [188534] (6 PDB entries)
  8. 1022420Domain d3zulc_: 3zul C: [186589]
    automated match to d1mova_

Details for d3zulc_

PDB Entry: 3zul (more details), 2.3 Å

PDB Description: padron on (fluorescent) icis intermediate state
PDB Compounds: (C:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d3zulc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zulc_ d.22.1.0 (C:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
vvqlpdyhsvdhhieikshdkdysnvnlhehaeahsel

SCOPe Domain Coordinates for d3zulc_:

Click to download the PDB-style file with coordinates for d3zulc_.
(The format of our PDB-style files is described here.)

Timeline for d3zulc_: