SCOPe 2.07: Domain d3zulb_: 3zul B:

Lineage for d3zulb_ (3zul B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (25 species)
   not a true protein

7. Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)

8. Domain d3zulb_: 3zul B: [186588]
   automated match to d1mova_

Details for d3zulb_

PDB Entry: 3zul, 2.3 Å

PDB Description: padron on (fluorescent) icis intermediate state

PDB Compounds: (B:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d3zulb_:

Sequence; same for both SEQRES and ATOM records:

>d3zulb_ d.22.1.0 (B:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs

Timeline for d3zulb_:

• d3zulb_ first appeared in SCOPe 2.01
  
• d3zulb_ appears in SCOPe 2.06
  
• d3zulb_ appears in the current release, SCOPe 2.08