Lineage for d3zuje_ (3zuj E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940765Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2940928Domain d3zuje_: 3zuj E: [186585]
    automated match to d1mova_

Details for d3zuje_

PDB Entry: 3zuj (more details), 2.35 Å

PDB Description: padron on (fluorescent) abcis
PDB Compounds: (E:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d3zuje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zuje_ d.22.1.0 (E:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
vvqlpdyhsvdhhieikshdkdysnvnlhehaeahs

SCOPe Domain Coordinates for d3zuje_:

Click to download the PDB-style file with coordinates for d3zuje_.
(The format of our PDB-style files is described here.)

Timeline for d3zuje_: