SCOPe 2.07: Domain d3zuca1: 3zuc A:5-153

Lineage for d3zuca1 (3zuc A:5-153)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (12 species)
   not a true protein

7. Species Acetivibrio cellulolyticus [TaxId:35830] [189869] (5 PDB entries)

8. Domain d3zuca1: 3zuc A:5-153 [186574]
   Other proteins in same PDB: d3zuca2
   automated match to d1nbca_
   complexed with 1pe, ca, edo, ni

Details for d3zuca1

PDB Entry: 3zuc, 1 Å

PDB Description: structure of cbm3b of major scaffoldin subunit scaa from acetivibrio cellulolyticus determined from the crystals grown in the presence of nickel

PDB Compounds: (A:) cellulosomal scaffoldin

SCOPe Domain Sequences for d3zuca1:

Sequence; same for both SEQRES and ATOM records:

>d3zuca1 b.2.2.0 (A:5-153) automated matches {Acetivibrio cellulolyticus [TaxId: 35830]}
nlkveffnagtqaqsnsiypkfrltntgsnainladvklhyyftvdgdkaqtfwcdwspv
gssnvtgtfvkmnptttgadqyleiafssaagtlaantsievqgrfaksdwtnynqaddy
sfnssattytswdkvtaysaegliwgiep

Timeline for d3zuca1:

• d3zuca1 first appeared in SCOPe 2.01, called d3zuca_
  
• d3zuca1 appears in SCOPe 2.06
  
• d3zuca1 appears in the current release, SCOPe 2.08